6T5LA

Myo-1 from myroides odoratimimus. environmental metallo-beta-lactamases exhibit high enzymatic activity under zinc deprivation
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
224
Chain Sequence
DSLIVYQTENLIINKLSNHIYEHISFLNTDDFGKVACNGMLVLNENKVVVFDTPTDDKSSLELINFVTNTLKSEIIGLIPTHFHDDCIGGITEFENHNIQTYVSKETIELLKDNGQEFSNPTKDFDNSLTLDIGNKKVYAEYFGEGHTKDNVVGYFPEDNAVFGGCLIKEIDASKGYLGDANIKEWSTTVEKVKLKYPNAKIVIPGHGKWGGIELFDYTIKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Subclass B1 metallo-beta-lactamase
publication title Structural and biochemical characterization of the environmental MBLs MYO-1, ECV-1 and SHD-1.
pubmed doi rcsb
source organism Myroides odoratimimus
total genus 66
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...