6T6ZA

Structure of the bottromycin epimerase both in complex with a bottromycin a2 derivative
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
253
structure length
253
Chain Sequence
RDVFEVFSRDGTPIRGFSRPGPGETVVLVHGVAMDRRIWAESGFLDALPDAHVLALDLRGRGESGRVGTAEGHALRRYVEDVRAVLDRFGRARYSLFGTFFGGRIALQVAAVDTRVARAFSFCAHAEQVEIPEDAVEEEAVAVEGPGGHAYLRDHFTGRGAPPWMVEACARVDPGELGAATRGLLHGSDRRTERGHPDQELVLITADGDADLAPFHAGERRLGAHLWLVDAPTRIKAAGRLAEVGRRVAGVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BotH
publication title The bottromycin epimerase BotH defines a group of atypical alpha / beta-hydrolase-fold enzymes.
pubmed doi rcsb
source organism Streptomyces sp. bc16019
total genus 101
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2019-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...