6TGTA

The calcium soaked crystal structure of the dps2 from deinococcus radiodurans to 2.16a resolution (soaked in cacl2 [5mm] for 20 min).
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
163
structure length
163
Chain Sequence
DLKKSVQALQNTLTELQALQLQTKQAHWNVSGTLWYTLHELLQDHYEGISKFADDVAERQLSVGASSDGRAITIVAASRLPEIPGGFLDDAQVIQFFTYQYETVGQRIHQRVGDVEKVDPTTANLLQEVEHIIEKYQWQMRAFLQNTPTDPNTGFDINNGKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA protection during starvation protein 2
publication title The Calcium soaked crystal structure of the DPS2 from DEINOCOCCUS RADIODURANS to 2.16A resolution (Soaked in CaCl2 [5mM] for 20 min).
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
total genus 66
structure length 163
sequence length 163
ec nomenclature ec 1.16.-.-:
pdb deposition date 2019-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...