6TH0A

Crystal structure of arabidopsis thaliana naa60 in complex with acetyl-coa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
176
structure length
176
Chain Sequence
TICFRPINPSDLERLEQIHRDIFPIRYESEFFQNVVNGGDIVSWAAVDRSRPDGHSEELIGFVTAKIVLAKESEISDLIRYDSSKGEGTLVYILTLGVVETYRKRGIAKALINEVVKYSSGIPVCRGVYLHVIAHNNPAIRLYKRMSFRCVRRLHGFYLINGQHFDSYLFVYFING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Acyl-CoA N-acyltransferases (NAT) superfamily protein
publication title The Arabidopsis Nalpha-acetyltransferase NAA60 locates to the plasma membrane and is vital for the high salt stress response.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 49
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...