6TK0X

Cytochrome c from thioalkalivibrio paradoxus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
153
structure length
153
Chain Sequence
MDIGINSDPHPPHHHDHHGHGSGWEVPEAEIHRENPIPPDARSLDQGGVLYAEHCVRCHGETLRGDGPDAHDLDPPVADLVEHAPHHSDGDLAYRVRIGRGPMPGFGDALDERDIWDLVNFMRDRAQGAALAGTNGHSPDHAAGDHHHGDHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c, mono-and diheme variants family
publication title Cytochrome C from Thioalkalivibrio paradoxus
rcsb
source organism Thioalkalivibrio nitratireducens dsm 14787
total genus 32
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2019-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...