6TO3AAA

Gstf1 from alopecurus myosuroides - covalently modified
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
217
structure length
190
Chain Sequence
APVKVFGPAMSTNVARVTLCLEEVGAEYEVVNIDFNPFGQIPAFQDGDLLLWESRAISKYVLRKYKTDEVDLLRESNLEEAAMVDVWTEVDAHTYNPALSPIVYQCLFNESLEKLKKVLEVYEARLSKHSYLAGDFVSFADLNHFPYTFYFMATPHAALFDSYPHVKAWWDRLMARPAVKKIAATMVPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase,Glutathione transferase
publication title GSTF1 from Alopecurus myosuroides
rcsb
source organism Alopecurus myosuroides
total genus 61
structure length 190
sequence length 217
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2019-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF00043 GST_C Glutathione S-transferase, C-terminal domain
AAA PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...