6TRVAAA

Structure of sapl1 lectin in complex with alpha methyl fucoside
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
294
structure length
294
Chain Sequence
SGVLQISFPAGIAAIRNNSSLRVYEAALDGGVREAQYEGRWAGGKPDNVIATGKIGTPIAATSVGFQYIRVYYVGADNKAREACWDGKGWYTGAFVKDVAPYSSIGAVFLGKNIVVRVYTQNHDNTIQEWVWDSPSTGWTAGANFGAALPGTAIAATSWGAGPYHIRVYFQDTNRNVIESGWDGSGWYTGGLKISNQSPRASLGATSWGESGSSLGIRLYYATQDNLIKEKAWDGGGGWYDGGFQQRSIPGSRVAAIPLPVLRVYLQNGTEVSGITEYAWNSGWVVGQAVLPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Uncharacterized protein
publication title Structure and specificity of SapL1: a Target for the Development of Antiadhesive Therapy Against Scedosporium apiospermum.
rcsb
source organism Scedosporium apiospermum
total genus 65
structure length 294
sequence length 294
chains with identical sequence BBB
ec nomenclature
pdb deposition date 2019-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...