6U425O

Natively decorated ciliary doublet microtubule
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
376
structure length
376
Chain Sequence
NLRYCFISEWLDPASGILWKYQLFYYPESKEVEMVDIKNRRHFLKRTKYEELKPSLLFLGSVVTVFSRQLKLTEYGDEFTRNRMESQSERTLAMIKPDAYKNMGKIINAICQSGFLISKLRIGKLSKEEAGEFYAVHAGKPFVDRLTDFMSSGRVVAMELVAPGAIRKWRELIGPTDSNQARAEAPGSLRAQFGTDKTFNACHGSDAPDTAAEECNFWFGPGRYPGKCDLAAGTTLCLVKPHLVADGAAGLVIDLIQESFEVTAGGLYNLDRNAAAEFLEVYKGVLPAGDFNSMVEQLTSGACIALEVADRDGADAVEPFRQLAGPLDPELGRVLRPASLRARFGLDAVRNGVHCTDLPEDGVLEVNYFFTILPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein fibril
molecule keywords Tubulin beta
publication title Structure of the Decorated Ciliary Doublet Microtubule.
pubmed doi rcsb
total genus 90
structure length 376
sequence length 376
chains with identical sequence 5P
ec nomenclature
pdb deposition date 2019-08-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...