6U6MH

Crystal structure of a vaccine-elicited anti-hiv-1 rhesus macaque antibody dh840.1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
218
Chain Sequence
QVQLKESGPGLVRPSETLSLTCAVSGTSINSAYAWGWVRLPPGKGLEWIMTVYTSTGNTYSDPSLKSRVTISKDTSKNQFSLRLSSVTVEDTAVYFCARADGSDSGWPHFDNWGQGLLVTVSSASTKGPSVFPLAPSSESTAALGCLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYVCNVNHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords DH840.1 Fab heavy chain
publication title CON-S immunogens repeatedly elicit C3/V4-targeting antibodies in non-human primates.
rcsb
source organism Macaca mulatta
total genus 41
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2019-08-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...