6UUPA

Structure of anti-hcd33 conditional scfv
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
253
structure length
227
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMHWVRQAPGKGLEWVAVISYDGRLKYYADSVKGRFTISRDNYLVYLQMNSLRAEDTAVYYCAAEEGDGGFFDYWGQGTLVTVSSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVNWYQQLPGTAPKLLIYRNNERPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDGSLSGRGVFGTGTKLTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Anti-CD33 conditional scFv
publication title Small molecule-regulated antibodies conditionally redirect CAR-Ts to CD33+ acute myeloid leukemia (AML) tumor
rcsb
source organism Camelidae mixed library
total genus 60
structure length 227
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2019-10-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...