6V4MA

Trichuris suis bcl-2
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
163
structure length
163
Chain Sequence
b'WDNELSGIQNTSVSLAADYVYMRLATEGFVFGIRSSVRAPIRLCDAMFLMCDLFERKFHDRYIAPLKNACLGISAKDMDMRMFFSALDSVFSSGISWSRIVAMYAFAGSVALACARQGRRQTVIAIPEWIMLYMRRAIAPWIHANGGWDSFIKFSQDVLNGNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BCL-2
publication title Diversity in the intrinsic apoptosis pathway of nematodes.
pubmed doi rcsb
source organism Trichuris suis
molecule tags Apoptosis
total genus 63
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2019-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00452 Bcl-2 Apoptosis regulator proteins, Bcl-2 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...