6V9IR

Cryo-em structure of cullin5 bound to ring-box protein 2 (cul5-rbx2)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
87
structure length
84
Chain Sequence
DKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of Cullin5 bound to RING-box protein 2 (Cul5-Rbx2)
rcsb
source organism Streptococcus sp. group g
molecule tags Ligase
molecule keywords Immunoglobulin G-binding protein G,Cullin-5
total genus 9
structure length 84
sequence length 87
ec nomenclature
pdb deposition date 2019-12-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...