6VE7A

The inner junction complex of chlamydomonas reinhardtii doublet microtubule
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
225
structure length
179
Chain Sequence
QEESVYALIPQPPAMHTSKFGGKTHPAQFDFGQNKVQPHATMGRPDGANGPAFLHAHEKEPKLPSPGPPSNPKQKIRPPVPAKEEKPTMGLTSNKNFITANAVDVILAKPGKVPQPEFQWTQKPDYGKVPMYLKRNKDRVAWGSVNTAYQGLSLSVDSAVKKGRKEAMERELAEIERDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Flagellar associated protein
publication title The inner junction complex of the cilia is an interaction hub that involves tubulin post-translational modifications.
pubmed doi rcsb
total genus 20
structure length 179
sequence length 225
ec nomenclature
pdb deposition date 2019-12-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...