6VEHA

Computationally designed c3-symmetric homotrimer from heat repeat protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
188
structure length
179
Chain Sequence
TDPMKVILYIAMLELEKYIMRAAAAYALGKIGDERAVEPLIKALKDEDAIVRAAAADALGQIGDERAVEPLIKALKDEDGAVRVSAAVALGQIGDERAVEPLIKALKDEDAVVRVAAAIALGLIGDERAVEPLIKALKDEKGKVREAAALALGAIGGERVRAAMFARKVAVNYLETHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords HEAT repeat domain-containing protein
publication title Tailored design of protein nanoparticle scaffolds for multivalent presentation of viral glycoprotein antigens.
pubmed doi rcsb
source organism Synthetic construct
total genus 65
structure length 179
sequence length 188
ec nomenclature
pdb deposition date 2020-01-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...