6VJZD

Cryoem structure of hrd1-usa1/der1/hrd3 complex of the expected topology
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
45
structure length
45
Chain Sequence
HNVLDVVLRYIIPDPVNDRVITAVIKNFVLFWVTLLPYVKEKLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of ER-associated protein degradation mediated by the Hrd1 ubiquitin ligase complex
doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Degradation in the endoplasmic reticulum protein 1
total genus 9
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2020-01-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...