6VQPA

Structure of calu17 from the calicheamicin biosynthesis pathway of micromonospora echinospora
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
292
structure length
292
Chain Sequence
AVPGDMVRIPGGTFLQGSPERTLDWLDREGQAFPRDWFTDETPQIPVTLPDYLIDRHQVTVAQFAAFVSRTGYVTSAERAGGSMVYGEQYWEIREGACWHRPAGYGSGIRGRDDHPVVHISFADAEAYARWAGRRLPTESEWERAATGPSYRLWPWGDTWDSRNANTAEHTAGALGDLDAWRTWWGAIHAVQGPMPQTTPVGAFSPRGDSVDGCADMTGNVYEWTSTLAHLYSPATRCDPTIHLVMGRSRVIRGGSWMNFRYQVRCAERLYGDPTGWSNFALGFRCARDVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords CalU17
publication title Structure of DynF from the Dynemicin Biosynthesis Pathway of Micromonospora chersina
rcsb
source organism Micromonospora echinospora
total genus 91
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2020-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03781 FGE-sulfatase Sulfatase-modifying factor enzyme 1
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...