6VTUH

Dh717.1 fab monomer in complex with man9 glycan
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
220
Chain Sequence
QVQLQESGPGLVKPSETLSLTCAVSGVSINDGYDWTWIRQTPGKGLEWIGYVFGRSGNFNLNPSLRNRGIISKDTCKNQFSLNLNSATAADTAVYFCARGMEGLFAAYNSLDVWGRGLLVTVSGASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords DH717.1 heavy chain
publication title Fab-dimerized glycan-reactive antibodies neutralize HIV and are prevalent in humans and rhesus macaques
rcsb
source organism Homo sapiens
total genus 45
structure length 220
sequence length 225
ec nomenclature
pdb deposition date 2020-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...