6W78A

Crystal structure of a plant ice-binding protein
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
310
structure length
310
Chain Sequence
QRCNNNDKQALLQIKTALKNPTITDSWVSDDDCCGWDLVECDETSNRIISLIIQDDEALTGQIPPQVGDLPYLQALWFRKLPNLFGKIPEEISALKDLKSLRLSSTSLSGPVPLFFPQLTKLTCLDLSFNKLLGVIPPQLSTLPNLKALHLERNELTGEIPDIFGNFAGSPDIYLSHNQLTGFVPKTFARADPIRLDFSGNRLEGDISFLFGPKKRLEMLDFSGNVLSFNFSRVQEFPPSLTYLDLNHNQISGSLSSELAKLDLQTFNVSDNNLCGKIPTGGNLQRFDRTAYLHNSCLCGAPLPECAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords Antifreeze polypeptide
publication title Carrot 'antifreeze' protein has an irregular ice-binding site that confers weak freezing point depression but strong inhibition of ice recrystallization.
pubmed doi rcsb
source organism Daucus carota
total genus 97
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2020-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...