6WAOA

Crystal structure of arabidopsis thaliana isochorismoyl-glutamate a pyruvoyl-glutamate lyase in complex with (2-(3-carboxyphenoxy)acetyl)-l-glutamic acid
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
431
structure length
431
Chain Sequence
ELVVISKSIVNPRSLKKPTSVKKIQLTPWDLSRLRFGYLQRGLLFHKIEVKQLQASLSVALDRFYPLAGRLVKLKNDDDTVSFFISCDGSGVEFVHAVAKNIELSDVLELSGSVPGFFASFFPATGIKNYHGVSRSLLMVQVTEMKDGVFIGFGYNSTVADATSIWKFINAWSEICSKDSSGSQTFQRRLHLKGWFFDEIDYPIHIPDPETKPTSYVTTPTNLQEKMFHVTKENVLKLDAKANDEADQKISSIQAVLAYIWRSMVKHSGMSREEETHCRLPINMRQRLNPPLEEECFGNVSQTGIATVTVGELLDHGLGWAAMQINNMELSQTDEKAKAFAENWVKNIKIPVSVGSKDLVVTNSHRFDVYCNDFGWGKPIAARAGPPYLNGRLVVFKGIGEASLDFQACLLPQVVEKLVKDAEFNEYVSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Protein ENHANCED PSEUDOMONAS SUSCEPTIBILITY 1
publication title The structural basis of the isochorismoyl-glutamate pyruvoyl-glutamate lyase activity of Arabidopsis EPS1 in salicylic acid biosynthesis
rcsb
source organism Arabidopsis thaliana
total genus 136
structure length 431
sequence length 431
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2020-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...