6WASG

Structure of d19.pa8 fab in complex with 1fd6 16055 v1v2 scaffold
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
57
Chain Sequence
CVTLECRQVNEEIKNCSFNATTEIRDKKVYALFYRLDIVPLEEERKGNSSKYRLINC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords GN1_PA8 Fab Heavy chain
publication title Structural Basis for Potent Tier 2 Autologous Neutralization Elicited by Vaccination
rcsb
source organism Homo sapiens
total genus 9
structure length 57
sequence length 72
chains with identical sequence J
ec nomenclature
pdb deposition date 2020-03-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...