6WB6A

2.05 a resolution structure of transferrin 1 from manduca sexta
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
660
structure length
653
Chain Sequence
SSYKLCVPAAYMKDCEQMLEVPTKSKVALECVPARDRVECLSFVQQRQADFVPVDPEDMYVASKIPNQDFVVFQEYRTDEEPDAPFRYEAVIVVHKDLPINNLDQLKGLRSCHTGVNRNVGYKIPLTMLMKRAVFPKMNDHSISPKENELKALSTFFAKSCIVGKWSPDPKTNSAWKSQYSHLCSMCEHPERCDYPDNYSGYEGALRCLAHNNGEVAFTKVIFTRKFFGLPVGTTPASPSNENPEEFRYLCVDGSKAPITGKACSWAARPWQGLIGHNDVLAKLAPLREKVKQLADSGAADKPEWFTKVLGLSEKIHHVADNIPIKPIDYLNKANYTEVIERGHGAPELVVRLCVTSNVALSKCRAMSVFAFSRDIRPILDCVQENSEDACLKSVQDNGSDLASVDDMRVAAAAKKYNLHPVFHEVYGELKTPNYAVAVVKKGTAYNKIDDLRGKKSCHSSYSTFSGLHAPLFYLINKRAIQSDHCVKNLGEFFSGGSCLPGVDKDDVSKLKKQCGSDSSAWKCLEEDRGDVAFVSSADLSHFDANQYELLCLNRDAGGRDVLSSFATCNVAMAPSRTWVAAKDFLSDVSIAHTPLSLAQMLATRPDLFNIYGEFLKNNNVIFNNAAKGLATTEKLDFEKFKTIHDVISSCGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the novel iron-coordination and domain interactions of transferrin-1 from a model insect, Manduca sexta.
pubmed doi rcsb
molecule keywords Transferrin
molecule tags Metal transport
total genus 210
structure length 653
sequence length 660
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...