6WC7A

Acyl carrier protein (acp) domain bound to dehydratase (dh) domain in fungal fatty acid synthase (fas)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
163
structure length
163
Chain Sequence
IADEPVKASLLLHVLVAHKLKKSLDSIPMSKTIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEETPLEELAETFQDTFSGALGKQSSSLLSRLISSKMPGGFTITVARKYLQTRWGLPSGRQDGVLLVALSNEPAARLGSEADAKAFLDSMAQKYASIVGVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steric occlusion regulates proximal interactions of acyl carrier protein domain in fungal fatty acid synthase.
pubmed doi rcsb
molecule keywords Fatty acid synthase subunit beta
molecule tags Transferase
source organism Saccharomyces cerevisiae
total genus 11
structure length 163
sequence length 163
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2020-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain
A PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily
A PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain
A PF18314 FAS_I_H Fatty acid synthase type I helical domain
A PF18325 Fas_alpha_ACP Fatty acid synthase subunit alpha Acyl carrier domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...