6WEO0

Il-22 signaling complex with il-22r1 and il-10rbeta
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
193
structure length
193
Chain Sequence
MIPPPEKVRMNSVNFKNILQWEVPAFPKTQLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVQVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKQGTNEKFQVVSPYDSEVLRNLEPWTTYCIQVQGFLLDQQRTGEWSEPICERT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Interleukin-10 receptor subunit beta
publication title The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 193
sequence length 193
chains with identical sequence 3, 6, 9, C, E, H, K, O, R, U, X
ec nomenclature
pdb deposition date 2020-04-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...