6WGGB

Atomic model of pre-insertion mutant occm-dna complex(orc-cdc6-cdt1-mcm2-7 with mcm6 whd truncation)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
361
structure length
326
Chain Sequence
KSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGAEGAKYVLQSLTVNSKKMYKLLIETQMQNRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKMEIIWVPYTYAELEKLLKTVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication/dna
molecule keywords Cell division cycle protein CDT1
publication title Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 81
structure length 326
sequence length 361
ec nomenclature
pdb deposition date 2020-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04084 ORC2 Origin recognition complex subunit 2
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...