6WGIF

Atomic model of the mutant occm (orc-cdc6-cdt1-mcm2-7 with mcm6 whd truncation) loaded on dna at 10.5 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
160
structure length
157
Chain Sequence
SLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication/dna
molecule keywords DNA (34-MER)
publication title Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 157
sequence length 160
ec nomenclature
pdb deposition date 2020-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF05460 ORC6 Origin recognition complex subunit 6 (ORC6)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...