6WJAA

Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
307
structure length
307
Chain Sequence
ERILVTGGAGFIGSHLVDALLAKGYAVRVLDDLSTGKVGNLPMGDAGLELLVGDAADAALLADAVQGCDAVVHLAAVASVQASVEDPVATHQSNFIATLRLCEAMTAAGIRRVVFASAAAVYGNNGEGTPIAEDTPKSPLTPFAADKLASEYYLDFYRRQHGLEPVILRFFNIFGPRQDPSSPYSGVISIFSERAKAGRPITLFGDGGQTRDFVYVADLVKILVQGLESPAPAADATNVGLGGVTTLNDLIGALQQISGKPLQVSHGATRSGDIRHSKADNRRLRERFDLGTPSSLAEGLERLYRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords NAD-dependent epimerase/dehydratase family protein
publication title PelX is a UDP-N-acetylglucosamine C4-epimerase involved in Pel polysaccharide-dependent biofilm formation.
pubmed doi rcsb
source organism Pseudomonas protegens
total genus 111
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...