6WK3A

Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
145
structure length
145
Chain Sequence
MAPTLSEQTRQLVRASVPALQKHSVAISATMYRLLFERYPETRSLFELPERVIHKLASALLAYARSIDNPSALQAAIRRMVLSHARAGVQAVHYPLVWECLRDAIKEVLGPDATETLLQAWKEAYDFLAHLLSTKEAQVYAVLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity-Oriented Enzymatic Synthesis of Cyclopropane Building Blocks
doi rcsb
source organism Rhodothermus marinus dsm 4252
molecule tags Metal binding protein
molecule keywords Nitric oxide dioxygenase
total genus 60
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 1.14.12.17: Nitric oxide dioxygenase.
pdb deposition date 2020-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...