6WKKA

Phage g gp27 major capsid proteins and gp26 decoration proteins
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
280
structure length
280
Chain Sequence
MSQLSNQEKEYLISKALETEEGRVALAQAMANPIRVSLDYQGVGRKLLVVDPLPQGALPVYDKDVDAKAFVISKRGQVPDQVIEGDRIQVPTFEIVSYPQVRFSQVKERRFNVIDRAQQRAKADIMAVEDAEIFSLLEGAATAVNAVTISSGGLQRAALTKAFQEVEKHDLVVTKIVMNASAFADIRAWGQNEFDPVTQHEVLQTGLFGHIWTADILISKKVPQNTVYVLADPEFVGVMPIRQDIQVIPADKPEELRLGWVIYEELGLAVVNSLAIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phage G Structure at 6.1 angstrom Resolution, Condensed DNA, and Host Identity Revision to a Lysinibacillus.
pubmed doi rcsb
molecule tags Virus
molecule keywords Gp27 major capsid protein
total genus 37
structure length 280
sequence length 280
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-04-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...