6WN1B

Plasmodium vivax reticulocyte binding protein 2b (pvrbp2b) bound to human monoclonal antibody 241242
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
225
structure length
221
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAVSGFTFRNYALSWVRQAPGKGLDWVSTISASGGATYYADSVKGHFTISRDNSKNILYLDMKSLRAEDTAIYYCARDGGSYTPYFFLDSWGQGALVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Reticulocyte binding protein 2b
publication title Naturally acquired blocking human monoclonal antibodies to Plasmodium vivax reticulocyte binding protein 2b
rcsb
source organism Plasmodium vivax sal-1
total genus 34
structure length 221
sequence length 225
chains with identical sequence E
ec nomenclature
pdb deposition date 2020-04-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...