6WN9A

Structure of staphylococcus aureus peptidoglycan o-acetyltransferase a (oata) c-terminal catalytic domain, zn-bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
155
structure length
155
Chain Sequence
SSPLLIGDSVMVDIGNVFTKKIPNAQIDGKVGRQLVDATPIVKSQYKDYAKKGQKVVVELGTNGAFTKDQLNELLDSFGKADIYLVSIRVPRDYEGRINKLIYEAAAARSNVHLVDWYKASAGHPEYFAYDGIHLEYAGSKALTDLIVKTMETHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for theO-acetyltransferase function of the extracytoplasmic domain of OatA fromStaphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Acetyltransferase
total genus 56
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2020-04-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...