6WNBA

Structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
333
structure length
320
Chain Sequence
TTADLILINNWHVVANVEDCKPGSITTARLLGVKLVLWRSQEQNSPIQVWQDYCPHRGVPLSMGEVANNTLVCPYHGWRYNQAGKCVQIPAHPDMVPPASAQAKTYHCQERYGLVWVCLGNPVNDIPSFPEWDDPNYHKTYTKSYLIQASPFRVMDNSIDVSHFPFIHDGWLGDRNYTKVEDFEVKVDKDGLTMGKYQFQTSRDDSWVNWFRLSHPLCQYCVSESPEMRIVDLMTIAPIDEDNSVLRMLIMWNGSEMLESKMLTEYDETIEQDIRILHSQQPARLPLLAGLPQEIHVPSDRGTVAYRRWLKELGVTYGVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords SxtT
publication title Structural basis for divergent C-H hydroxylation selectivity in two Rieske oxygenases.
pubmed doi rcsb
source organism Microseira wollei
total genus 77
structure length 320
sequence length 333
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2020-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF19112 VanA_C Vanillate O-demethylase oxygenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...