6WQYA

Gh5-4 broad specificity endoglucanase from bacteroides salanitronis
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
379
structure length
379
Chain Sequence
HHHHHENLYFQSVSGETPLEIAVSLGLGWNLGNQLDAHNNGVADETSWGNAAATQALFDALANAGFTSVRIPVTWLGHVGEAPDYTIDETYLNRVAEVVGYAESAGLNAIINIHHDGANSQYWLDIKDAATDETVNSAVKAQLAAMWTQIANRFADKGNFLVFEAMNEIHDGSWGWGDNRTDGGRQYAVLNEWNQVFVDAVRATGGNNQTRYLGVPGYVTNIDLTVENFVLPQDVVDNRLMVAVHFYDPIDYTENADNIYSQWGHTADPSLKADWGDEDNVTGQFAKMKETFIDQGIPAYIGEMGCVHRADDLSESFRLYYLEYVCKAAKDYGMPPFYWDAGGDGTGTQSWALFNHATGEMLNNAQEVIDVMKRGIFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Perspectives on Multifunctional GH5 Cellulases
rcsb
molecule keywords Cellulase
molecule tags Hydrolase
source organism Bacteroides salanitronis (strain dsm 18170 / jcm 13567 / bl78)
total genus 150
structure length 379
sequence length 379
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2020-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...