6WT5A

Structure of a bacterial sting receptor from capnocytophaga granulosa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
161
structure length
144
Chain Sequence
DSDINFFPSSTLAAVYYENFIKPTCSHIINNGGLLDYIYKKCTIKIIIPKKLTSDVNSQFQRIKAKIETKELSFEYLPRNINVEDGEVMIIDFPTILSGINYAISNLLPDYEAILSRELERFVYTLKKIALRDGFDDLIKIVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Bacterial STING
publication title STING cyclic dinucleotide sensing originated in bacteria
doi rcsb
source organism Capnocytophaga granulosa
total genus 42
structure length 144
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2020-05-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...