6WXLF

Cryo-em structure of the vrc315 clinical trial, vaccine-elicited, human antibody 1d12 in complex with an h7 sh13 ha trimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
125
Chain Sequence
QLVQSGAEVKKPGASVKVSCKASGYTFTGYYLHWVRQAPGQGLEWMGRINPDTGGTNYAQKFQGRVSMTRDMSISTHYMELSRLTSDDTAVYYCATKRGAVTAMVYYYFYGMDVWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin HA1 chain
publication title Cryo-EM structure of the VRC315 clinical trial, vaccine-elicited, human antibody 1D12 in complex with an H7 SH13 HA trimer
rcsb
source organism Influenza a virus (a/shanghai/js01/2013(h7n9))
total genus 21
structure length 125
sequence length 125
chains with identical sequence H, K
ec nomenclature
pdb deposition date 2020-05-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...