6WZ0A

Fe-bound structure of an engineered metal-dependent protein trimer, tricyt2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAKKATPPKLEDKSPASPEMIDFRVGFDILLWQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
publication title Metal-Templated Design of Chemically Switchable Protein Assemblies with High-Affinity Coordination Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2020-05-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...