6X1IA

Two-component d3 assembly constructed by fusing symmetric oligomers to coiled coils
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
171
structure length
171
Chain Sequence
b'SPIIEANGTLDELTSFIGEAKHYVDEEMKGILEEIQNDIYKIMGEIGSKGKIEGISEERIKWLEGLISRYEEMVNLKSFVLPGGTLESAKLDVCRTIARRAERKVATVLREFGIGKEALVYLNRLSDLLFLLARVIEIAAAAQLEKELQALEKENAQLEWELQALEKELAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cob_adeno_trans domain-containing protein PH0671 fused to a
publication title Geometric Lessons and Design Strategies for Nanoscale Protein Cages
rcsb
source organism Pyrococcus horikoshii (strain atcc 700860 / dsm 12428 / jcm 9974 / nbrc 100139 /
molecule tags Biosynthetic protein
total genus 73
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2020-05-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...