6X5JB

Discovery of hydroxy pyrimidine factor ixa inhibitors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
55
structure length
50
Chain Sequence
DVTCNIKNGRCEQFCKNVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Coagulation factor IX
publication title Discovery of hydroxy pyrimidine Factor IXa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 50
sequence length 55
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2020-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...