6X6KAX

Cryo-em structure of the helicobacter pylori dcag3 omc
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
155
Chain Sequence
QIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIFDDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDKALVTVINKGYGKNPLTKNYNIKNYGELERVIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Cag pathogenicity island protein
publication title Cryo-EM analysis of the Helicobacter pylori Cag type IV secretion system reveals an expanded core complex and unique species-specific components
rcsb
total genus 32
structure length 155
sequence length 155
chains with identical sequence BX, CX, DX, EX, FX, GX, HX, IX, JX, KX, LX, MX, NX
ec nomenclature
pdb deposition date 2020-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AX PF03524 CagX Conjugal transfer protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...