6XH3A

Co-crystal structure of hiv-1 tar rna in complex with lab-evolved rrm tbp6.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
b'TRPNHTIYINNLNSKIKKDELKKSLHAIFSRFGQILDILVPRTRRPRGQAFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDRTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAR BINDING PROTEIN TBP 6.3
publication title Co-crystal structures of HIV TAR RNA bound to lab-evolved proteins show key roles for arginine relevant to the design of cyclic peptide TAR inhibitors
rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2020-06-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...