6XIGA

X-ray crystal structure of mqne from pedobacter heparinus
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
391
structure length
379
Chain Sequence
GTENLYFQSMDTTSKLALILADADLPAALKAIALKVQNQERITFDEGVYLYENAELGYLGVLANYIREQKHGDNTYFNRNFHIEPTNVCVYDCKFCSYSRLIGWEMSVDGMMEVLKKYDHEPVTEVHITGGVVPKQNLEFYSDFFRRAKAHRPELHIKALTPVEYYYIFKKAKLSHYDGMKYMQEAGLDSMPGGGAEIFHPEVREKIAHDKCNAEQWLDIHEQAHKLGMKTNATMLYGHIEQFWHRVDHMERLRRQQDKTGGFQAFIPLKFRNQHNQMDHVPEVSVIEDLRNYAIARIYMDNFDHIKAYWAMISRQTAQLSLNFGVDDIDGTLDDTTKIYSMPAMSTRDLVDLIKQVKRKPIERDTLYNVVTDYSQVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Aminodeoxyfutalosine synthase
publication title Narrow-Spectrum Antibiotic Targeting of the Radical SAM Enzyme MqnE in Menaquinone Biosynthesis.
pubmed doi rcsb
source organism Pedobacter heparinus (strain atcc 13125 / dsm 2366 / cip 104194 / jcm 7457 / nbr
total genus 150
structure length 379
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.5.1.120: Aminodeoxyfutalosine synthase.
pdb deposition date 2020-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...