6XIZA

Crystal structure of multi-copper oxidase from pediococcus acidilactici
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
477
structure length
477
Chain Sequence
b'SMITKYLYDENAYDYHDGGYRPLKKAPGEEHPLNVPAFLKPDRIEGNEIYYTVTAQAGETKILPGKPTHTWGYNGSILGPAIQFETGKTYHVTLKNELDEVTTFHWHGLNIVGPYEDGGPHAPVYPHGERKITFTVDQPAANIWLHPHPCPETARQVWNGLAAPVIITDGHEQSLKLPRRWGVNDFPVVLQDRSYHDNQLDYKADYDVDGTLGDYALVNGTVNPVVNVTKPIVRLRFLNGSNRREWRLHFADYHPFTQIGSDGGLLPEAVKMDRIMLTCAERADVLVNFSDYQPGQEVILQTDDFDLIKFKIGDIKKENMLLPSPLAEIPALSVDENTPVFKTVMSGMDDQVRLDGKLFDMQRIDTRQQVDQTQIWEVSNTNDMEGGMIHPFHIHGCQFQLIDRNGHAVNPNEHGWKDTIGVNPNETVRIKVKFTKLGIFMYHCHILEHEDTGMMAQIEIFDPDHPIEYHLMPMNHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Copper oxidase
publication title Structural analysis and biochemical properties of laccase enzymes from two Pediococcus species.
pubmed doi rcsb
source organism Pediococcus acidilactici
molecule tags Oxidoreductase
total genus 141
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...