6XLJG

Cryo-em structure of ecmrr-rnap-promoter initial transcribing complex with 4-nt rna transcript (ecmrr-rpitc-4nt)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
268
structure length
268
Chain Sequence
SQIGLFSKICRVTIKTLHYYNKIGLLVPAYINPDNGYRFYTSDQLMKFHQIASLRQLGFTITEIVTLTQDENSCHIIERRRLEIQKQIRDMADMLSRINHYLQHKKKERIMLYQAALKEIPECIVYSKRFIVPDFSSYIKLIPPIGQEVMKANPGLTLTTPAYCFTLYHDKEYKEKNMDVEFCEAVNDFGKNEGNIIFQVIPAITAVTVIHKGPYDSLRNAYIYLMQWVEDNGYLLTNSPRESYIDGIWNKQDSAEWMTEIQFPVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural visualization of bacterial multidrug-activated transcription
rcsb
source organism Escherichia coli o157:h7
total genus 71
structure length 268
sequence length 268
chains with identical sequence H
ec nomenclature
pdb deposition date 2020-06-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...