6XNQA

Crystal structure of argininosuccinate synthase from legionella pneumophila philadelphia 1
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
401
structure length
389
Chain Sequence
VIKKIALAYSGGLDTSIMIPWLKEHYEHAEVIAVICDLGQQEDLDAIKNKALKSGASKAYVVDVKNEFATQYLWPLVKSGALYEDQYILGTISRPLIAQKLVEIALTEQVNAVAHGATGKGNDQVRFEYSIKALAPQLEIIAPWRTWDIKSRQEAIVYAKAHGIEVPVTPKAPYSRDHNIWYISHEGGVLEDPSQEMPNDVLLMTAPVSQTPDEEEVVVLDFKKGVPVALNGQELSPVDLLNSLNQKAGQHGIGVADIVENRLVGMKIRGIYEAPAAAVLYKAHKLLESLCLTRSTLHLKQSLQQTYANLVYEGRWFSQTKQALDAFIDVTQQHVTGCVKLKLFKGNIIPAGMHSPYSLHHNQKDAEGFINLFSLSAKIYSQVHQGGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Argininosuccinate synthase
publication title Crystal Structure of Argininosuccinate synthase from Legionella pneumophila Philadelphia 1
rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
total genus 136
structure length 389
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 6.3.4.5: Argininosuccinate synthase.
pdb deposition date 2020-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00764 Arginosuc_synth Arginosuccinate synthase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...