6XNVA

Crystal structure of listeria monocytogenes cbpb protein (lmo1009) in complex with c-di-amp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
133
Chain Sequence
NELADSMISAEKVAHVQLGNNLEHALLVLTKCGYSVIPVLDFEFKLHGLISAAMITDAILGLRIEFERLEDLKVEDVMQTDFPVIKDFNNNERIVHLLVDHPFVCVVDSDHHFEGIVTRRVVLKQVNRYIHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytosolic protein
molecule keywords CBS domain-containing protein
publication title (p)ppGpp and c-di-AMP Homeostasis Is Controlled by CbpB in Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 35
structure length 133
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-07-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...