6XQ4C

Human antibody s8v2-47 in complex with the influenza hemagglutinin head domain of a/beijing/262/1995(h1n1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
223
structure length
223
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTVSRNYMSWVRQAPGKGLEWVSIIYSGDDTYYADSVKGRFTISRDNSKNTLYLEMNSLRAEDTAVYYCARGEMGDGYYWAPFDYWGQGTLVTVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
publication title A focused and dominant human antibody response to the influenza hemagglutinin head interface
rcsb
source organism Influenza a virus (a/beijing/262/1995(h1n1))
total genus 33
structure length 223
sequence length 223
chains with identical sequence E
ec nomenclature
pdb deposition date 2020-07-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...