6XRSA

Crystal structure of a gtp-binding protein enga (der homolog) from neisseria gonorrhoeae bound to gdp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
433
structure length
388
Chain Sequence
IMKPTIALIGRPNVGKSTLFNRLTRTKDALVHDLPGLTRDRHYGHGKVGSKPYFVIDTGGFEMAKQTLQAVDEADAVVFLVDGRTGLTPQDKIIADRLRQSPRPVYLAVNKGEDRAVLAAEFYELALGEPHVISGAHGDGVYYLIEEILENFPEADAKHPVFAVIGRPNVGKSTLVNAILGEKRVIASIHIDFEREGKPFTIIDKFSVIKAMQAVEAANVAVLVLDAQQDIADQDATIAGFALEAGRALVVAVNKWDGISEERREQVKRDISRKLYFLDFAKFHFISALKERGIDGLFESIQAAYNAAMIKMPTPKITRVLQTAVGRQQPPVRPKMRYAHQGGMNPPVIVVHGNSLHAISDSYTRYLTQTFRKAFNLQGTPLRIQYNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase Der
publication title Crystal structure of a GTP-binding protein EngA (Der homolog) from Neisseria gonorrhoeae bound to GDP
rcsb
source organism Neisseria gonorrhoeae (strain nccp11945)
total genus 122
structure length 388
sequence length 433
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2020-07-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...