6XU4A

Crystal structure of the genetically-encoded fgcamp calcium indicator in its calcium-bound state
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
410
structure length
389
Chain Sequence
RRTLHKAIDTVRAINKLREGLGNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGYYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYDVTLMADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLDQNPSESELQDMINEVDADNNGTIDFPEFLTMMARKMKDTDSEEEIREACKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords FGCamp
publication title Crystal structure of the genetically-encoded FGCaMP calcium indicator in its calcium-bound state
rcsb
source organism Aspergillus niger
total genus 113
structure length 389
sequence length 410
chains with identical sequence B, E
ec nomenclature
pdb deposition date 2020-01-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...