6XX1C

The unique cbm3-clocl_1192 of hungateiclostridium clariflavum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
150
structure length
148
Chain Sequence
HMKIELKYKNGRTNVNTDTIYPMFTIVNKGNQKVKLSNIKIRYYYTKEGNASETFWCDYFTKGSSNVIGSFAKLNKNNANSYLEISFSDAAGEIGAGESVELSVGFAKNDWSQYNQKNDYSYSSSTTYFSWNKVTLYVSGKLVFGKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cellulose binding domain-containing protein
publication title The unique CBM3-Cthe_0271 from Ruminoclostridium thermocellum and CBM3-Clocl_1192 from Hungateiclostridium clariflavum
rcsb
source organism Hungateiclostridium clariflavum (strain dsm 19732 / nbrc 101661 / ebr45)
total genus 42
structure length 148
sequence length 150
chains with identical sequence D
ec nomenclature
pdb deposition date 2020-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...