The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
150
|
structure length |
148
|
Chain Sequence |
HMKIELKYKNGRTNVNTDTIYPMFTIVNKGNQKVKLSNIKIRYYYTKEGNASETFWCDYFTKGSSNVIGSFAKLNKNNANSYLEISFSDAAGEIGAGESVELSVGFAKNDWSQYNQKNDYSYSSSTTYFSWNKVTLYVSGKLVFGKEP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Cell adhesion
|
molecule keywords |
Cellulose binding domain-containing protein
|
publication title |
The unique CBM3-Cthe_0271 from Ruminoclostridium thermocellum and CBM3-Clocl_1192 from Hungateiclostridium clariflavum
rcsb |
source organism |
Hungateiclostridium clariflavum (strain dsm 19732 / nbrc 101661 / ebr45)
|
total genus |
42
|
structure length |
148
|
sequence length |
150
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2020-01-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF00942 | CBM_3 | Cellulose binding domain |
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...