6Y2DA

Crystal structure of the second kh domain of fubp1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
65
Chain Sequence
MNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIADKPLRITGDPYKVQQAKEMVLELIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Far upstream element-binding protein 1
publication title Crystal structure of FUBP1 KH domain
rcsb
source organism Homo sapiens
total genus 20
structure length 65
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2020-02-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...