6Y4BA

Structure of cyclodipeptide synthase from candidatus glomeribacter gigasporarum bound to phe-trnaphe
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
260
structure length
255
Chain Sequence
GLEQFILENSLIKNKPIKIVIGISMQSPHQISNEHKQSGDSFRAFVDLLRKTNEQCIRDENIRISELIVVITDGLHRHNLRLYKNVSTTEAESEAAGLGQKWVADNRQFLEAIGQCGISYKVIHWEELKSVAFNRYLQIVEEEYEKPNSEFRSIIDNLTQTHLEKLVNFLLETRDSSFTQEDCVSATRKYLLEEAASAFEFASLKADGMTYPGPCSPGFKYIYDTYLSESNPLPFIEYGMRGGKKLPSFWKEESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA (77-MER)
publication title Structural basis of the interaction between cyclodipeptide synthases and aminoacylated tRNA substrates.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 255
sequence length 260
ec nomenclature
pdb deposition date 2020-02-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...